PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010940742.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 503aa    MW: 57426.5 Da    PI: 6.9318
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010940742.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1821.5e-5661331128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     lppGfrFhPtdeelv +yLk+k++g+k+el e+i+evd+yk+ePwdLp k  + +++ ewyfFs+rd+ky++g+r+nratk gyWkatgkd++v+
  XP_010940742.1   6 LPPGFRFHPTDEELVAYYLKRKINGHKIEL-EIIPEVDLYKCEPWDLPgKsLLPSKDLEWYFFSPRDRKYPNGSRTNRATKLGYWKATGKDRKVT 99 
                     79****************************.99***************6434555777************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       ++++vg+kktLv+y+grap+g++t+Wvmheyrl
  XP_010940742.1 100 L-QKRTVGMKKTLVYYRGRAPHGSRTNWVMHEYRL 133
                     *.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.31E-644156IPR003441NAC domain
PROSITE profilePS5100561.2056156IPR003441NAC domain
PfamPF023653.0E-307133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 503 aa     Download sequence    Send to blast
MAPIGLPPGF RFHPTDEELV AYYLKRKING HKIELEIIPE VDLYKCEPWD LPGKSLLPSK  60
DLEWYFFSPR DRKYPNGSRT NRATKLGYWK ATGKDRKVTL QKRTVGMKKT LVYYRGRAPH  120
GSRTNWVMHE YRLDEKECET NSGLQDAYSL CRVFKKSMLG PKIIDRYNAS HEEHSQRMLS  180
DNTLTTDALA DGGEGRESYG YLYPLETCSS NRPQGALCDA NTPITDKWVQ LLADEAFIST  240
PMLFDNPLKN CYIQSKVDVA LECAKLQHRL SLPPLELEDF PQIDLLNTKA LECGFIEGNT  300
SEVDALQEIL SVASASQELI NNPNYPYAWT KVSPYFMKPI DEQKIDGSTR LCQMESVGEQ  360
ASLRDISELE EELMEEKKTV ENLRKITMSM SDTVKGDTNH GYFVSSGSMT ETLFHHVESL  420
EKVSIHWNPI AKLDSRVREF GFSMKDRGRV SVFVTFKAIL GDKLKRLMIS MKKCRRSCLD  480
DEAVDAFINM SHFKGRSLQV SNA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-57115612165NO APICAL MERISTEM PROTEIN
1ut4_B3e-57115612165NO APICAL MERISTEM PROTEIN
1ut7_A3e-57115612165NO APICAL MERISTEM PROTEIN
1ut7_B3e-57115612165NO APICAL MERISTEM PROTEIN
3swm_A4e-57115615168NAC domain-containing protein 19
3swm_B4e-57115615168NAC domain-containing protein 19
3swm_C4e-57115615168NAC domain-containing protein 19
3swm_D4e-57115615168NAC domain-containing protein 19
3swp_A4e-57115615168NAC domain-containing protein 19
3swp_B4e-57115615168NAC domain-containing protein 19
3swp_C4e-57115615168NAC domain-containing protein 19
3swp_D4e-57115615168NAC domain-containing protein 19
4dul_A3e-57115612165NAC domain-containing protein 19
4dul_B3e-57115612165NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010940742.10.0PREDICTED: NAC domain-containing protein 86-like
TrEMBLJ3LJC71e-153J3LJC7_ORYBR; Uncharacterized protein
STRINGOB03G11530.11e-153(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP66243651
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65910.11e-114NAC domain containing protein 28